IthaID: 4102

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 20 CAC>CAG [His>Gln] HGVS Name: HBA1:c.63C>G
Hb Name: Hb Ormylia Protein Info: α1 20(B1) His>Gln
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CCGCCTGGGGTAAGGTCGGCGCGCA [C/G] GCTGGCGAGTATGGTGCGGAGGCCC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAQAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Hb Ormylia is a stable variant eluted in the P3 window in HPLC. Found in 11 cases, from Northern Greece, with normal clinical picture.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37642
Size: 1 bp
Located at: α1
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Greek
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Vousvouki M, Delaki EE, Boutou E, Yfanti E, Mantzou G, Karipidou C, Vyzantiadis A, Efstathiou A, Dimopoulou M, Vlachaki E, Theodoridou S, A New α1-Globin Variant, Hb Ormylia [:c.63C > G; p.His21Gln]. Report of Eleven Cases in Northern Greece., Hemoglobin, 48(2), 133-137, 2024
Created on 2024-06-14 13:09:57, Last reviewed on 2024-06-14 13:11:29 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.