
IthaID: 494
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Benign / Likely Benign |
|---|---|---|---|
| Common Name: | CD GCG>GAG [Ala>Glu] | HGVS Name: | HBA2:c.80C>A |
| Hb Name: | Hb Shenyang | Protein Info: | α2 26(B7) Ala>Glu |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
GGCGCGCACGCTGGCGAGTATGGTG [C/A] GGAGGCCCTGGAGAGGTGAGGCTCC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGEEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | Unstable |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 33855 |
| Size: | 1 bp |
| Located at: | α2 |
| Specific Location: | Exon 1 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Chinese, Thai |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Zeng YT, Huang SZ, Zhou XD, Qiu XK, Dong QY, Li MY, Bai JH, Hb Shenyang (alpha 26 (B7) Ala replaced by Glu): a new unstable variant found in China., Hemoglobin , 6(6), 625-8, 1982
- Yi CH, Li HJ, Li HW, Zhang XS, Zhao XN, Zhang CT, Hemoglobin Shenyang found among Uygurs in P.R. China., Hemoglobin , 13(1), 97-9, 1989
- Panyasai S, Kongthai K, Phasit A, Association of Hb Shenyang [α26(B7)Ala→Glu, GG>GG, : c.80C>A (or )] with Several Types of α-Thalassemia in Thailand., Hemoglobin, 44(5), 354-360, 2020
Created on 2010-06-16 16:13:15,
Last reviewed on 2021-04-07 09:47:17 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.