
IthaID: 502
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Benign / Likely Benign |
---|---|---|---|
Common Name: | CD 30 GAG>CAG [Glu>Gln] | HGVS Name: | NM_000558.5(HBA1):c.91G>C |
Hb Name: | Hb G-Honolulu | Protein Info: | α1 30(B11) Glu>Gln |
Also known as: | Hb G-Chinese, Hb G-Hong Kong, Hb G-Singapore |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
TGGCGAGTATGGTGCGGAGGCCCTG [G/C] AGAGGTGAGGCTCCCTCCCCTGCTC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALQRMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Comments: Reported in both HBA1 and HBA2 genes.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 37670 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 1 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | Chinese, Malay |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
HPLC
Disclaimer: The HPLC images are provided as an information resource only.
Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes.
D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission.
Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc.
To access HPLC images and reports for different variants, use the IthaChrom tool.
ID | Hb Variant | Gene | Instrument | Method | Area (%) | Ret Time (min) | Comments | ||
---|---|---|---|---|---|---|---|---|---|
52 | Hb G-Honolulu | α1 | D-10 | Dual Kit Program | 19.4 | 3.83 | Heterozygous. Clinically normal. | [PDF] | |
53 | Hb G-Honolulu | α1 | VARIANT II | Dual Kit Program | 21.1 | 3.8 | Heterozygous. Clinically normal. Hb G-Honolulu elutes together with HbA2. | [PDF] | |
54 | Hb G-Honolulu | α1 | VARIANT II | Dual Kit Program | 20.2 | 3.18 |
In silico pathogenicity prediction
Publications / Origin
- Blackwell RQ, Weng MI, Liu CS, Shih TB, Wang CL, Hemoglobin G Chinese in Chinese subjects in Taiwan., Vox Sang. , 23(4), 363-8, 1972
- Liu GY, Zhang GX, Nie SY, Luo HY, Tao ZY, Zhang LY, Chen SS, Jia PC, Liang ZC, [A case of HbG Chinese found in Henan]., Zhongguo Yi Xue Ke Xue Yuan Xue Bao , 6(1), 48-50, 1984
- Chang JG, Shih MC, Liu SC, Chen CM, Chan WL, Peng CT, Hb G-Chinese: a G-->C substitution at codon 30 of the alpha2-globin gene creates a PstI cutting site., Hemoglobin , 26(1), 95-7, 2002
- Chang JG, Shih MC, Liu SC, Chen CM, Chan WL, Lee TP, Peng CT, Hb G-Honolulu [alpha30(B11)Glu-->Gln (alpha2)], Hb J-Meinung [beta56(D7)Gly-->Asp], and beta-thalassemia [codons 41/42 (-TCTT)] in a Taiwanese family., Hemoglobin , 26(3), 325-8, 2002
- Paleari R, Caruso D, Giavarini F, Colzani C, Brunati P, Mosca A, The first case of Hb G-Honolulu [α30(B11)Glu→Gln (GAG>CAG); HBA2:c.91G>A] observed in association with Hb S [β6(A3)Glu→Val, GAG>GTG] in a healthy Italian child., Hemoglobin , 36(1), 73-9, 2012
Microattributions
A/A | Contributor(s) | Date | Comments |
---|---|---|---|
1 | Mohd Yasin, Norafiza | 2020-11-24 | Report of an update. |
Created on 2010-06-16 16:13:15,
Last reviewed on 2024-04-12 09:50:40 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.