IthaID: 503



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 30 GAG>AAG [Glu>Lys] HGVS Name: HBA2:c.91G>A
Hb Name: Hb O-Padova Protein Info: α2 30(B11) Glu>Lys
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGGCGAGTATGGTGCGGAGGCCCTG [G/A] AGAGGTGAGGCTCCCTCCCCTGCTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALKRMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 33866
Size: 1 bp
Located at: α2
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Italian, Turkish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
305 Hb O-Padova α2 D-10 Dual Kit Program 14.2 4.42 Heterozygote, clinically normal. [PDF]
306 Hb O-Padova α2 VARIANT β-thal Short Program 15.3 4.73 Heterozygote. Clinically normal. [PDF]
307 Hb O-Padova α2 VARIANT II β-thal Short Program 16.7 4.79 Heterozygote. Clinically normal. [PDF]
308 Hb O-Padova α2 VARIANT II Dual Kit Program 14.5 3.93 Heterozygote. Clinically normal. [PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Vettore L, De Sandre G, Di Iorio EE, Winterhalter KH, Lang A, Lehmann H, A new abnormal hemoglobin O Padova, alpha 30 (B11) Glu -- Lys, and a dyserythropoietic anemia with erythroblastic multinuclearity coexisting in the same patient., Blood , 44(6), 869-77, 1974 PubMed
  2. Barbui T, Capaldi A, Trento M, Rabino-Massa E, Decrescenzo A, Modica A, Rege-Cambrin G, Ricco G, Association between Hb O Padova [alpha 30 (B 11) Glu leads to Lys] and Rendu-Osler disease., Panminerva Med , 25(1), 31-5, 1983 PubMed
  3. Kilinç Y, Kumi M, Gurgey A, Altay C, Webber BB, Wilson JB, Kutlar A, Huisman TH, Hemoglobin O-Padova or alpha(2)30(B11)Glu----Lys beta 2 observed in members of a Turkish family., Hemoglobin , 9(6), 621-5, 1985 PubMed
  4. Martín G, Villegas A, Calero F, del Palacio S, López JC, López M, Espinós D, Hb O Padova in a Spanish Family., Acta Haematol. , 84(1), 1-4, 1990 PubMed
  5. Schnedl WJ, Reisinger EC, Katzensteiner S, Lipp RW, Schreiber F, Hopmeier P, Krejs GJ, Haemoglobin O Padova and falsely low haemoglobin A1c in a patient with type I diabetes., J. Clin. Pathol. , 50(5), 434-5, 1997 PubMed
  6. Schnedl WJ, Krause R, Halwachs-Baumann G, Trinker M, Lipp RW, Krejs GJ, Evaluation of HbA1c determination methods in patients with hemoglobinopathies., Diabetes Care , 23(3), 339-44, 2000 PubMed
  7. Lahousen T, Roller RE, Lipp RW, Schnedl WJ, Silent haemoglobin variants and determination of HbA(1c) with the HPLC Bio-Rad Variant II., J. Clin. Pathol. , 55(9), 699-703, 2002 PubMed
Created on 2010-06-16 16:13:15, Last reviewed on 2021-04-02 11:32:15 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.