
IthaID: 527
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 43 TTC>GTC [Phe>Val] | HGVS Name: | HBA1:c.130T>G | HBA2:c.130T>G |
| Hb Name: | Hb Torino | Protein Info: | α2 or α1 43(CE1) Phe>Val |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
GTCCTTCCCCACCACCAAGACCTAC [A/G/T] TCCCGCACTTCGACCTGAGCCACGG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYVPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | N/A |
| Stability: | Unstable |
| Oxygen Affinity: | N/A |
| Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 34022 or 37826 |
| Size: | 1 bp or 1 bp |
| Located at: | α1 or α2 |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | Italian, Lebanese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
In silico pathogenicity prediction
Publications / Origin
- Beretta A, Prato V, Gallo E, Lehmann H, Haemoglobin Torino--alpha-43 (CD1) phenylalanine replaced by valine., Nature , 217(5133), 1016-8, 1968
- Prato V, Gallo E, Ricco G, Mazza U, Bianco G, Lehmann H, Haemolytic anaemia due to haemoglobin Torino., Br. J. Haematol. , 19(1), 105-15, 1970
- Sansone G, Sciarratta GV, Lang A, Lorkin PA, Lehmann H, A drug-induced haemolytic anaemia due to Hb Torino (alpha43(CD1)Phe replaced by Val). second finding in an Italian family., Acta Haematol. , 56(4), 225-33, 1976
- Stratta O, Capaldi A, Rege Cambrin G, Cravetto C, Furlani C, Bertello PD, Izzo P, Rabino-Massa E, Ricco G, A new case of Hb Torino found in a Lebanese woman., Panminerva Med , 24(3), 227-30, 1982
- Ricco G, Scaroina F, Burzio P, Bertello PD, Vietti-Ramus G, Gallione S, Gurioli L, Montinaro E, Functional properties of the unstable Hb-Torino: alpha 43 (CD-1) Phe-Val., Boll. Soc. Ital. Biol. Sper. , 61(4), 619-26, 1985
- Rabino-Massa E, Tosetti F, Marchisio U, Pio C, Frascisco M, Gurioli L, Oneglia C, Ricco G, Further studies on the oxygen affinity of whole blood containing two different haemoglobins: I. The case of Hb-A associated with one hypoaffine Hb., Boll. Soc. Ital. Biol. Sper. , 62(1), 23-30, 1986
- Castagnola M, Dobosz M, Landolfi R, Pascali VL, de Angelis F, Vettore L, Perona G, Determination of neutral haemoglobin variants by immobilized pH gradient, reversed-phase high-performance liquid chromatography and fast-atom bombardment mass spectrometry: the case of a Hb Torino alpha 43 (CE1) Phe----Val., Biol. Chem. Hoppe-Seyler , 369(4), 241-6, 1988
Created on 2010-06-16 16:13:15,
Last reviewed on 2014-03-18 15:30:51 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.