IthaID: 551



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 50 CAC>CGC [His>Arg] HGVS Name: HBA1:c.152A>G | HBA2:c.152A>G
Hb Name: Hb Aichi Protein Info: α2 or α1 50(CE8) His>Arg

Context nucleotide sequence:
TACTTCCCGCACTTCGACCTGAGCC [A/G] CGGCTCTGCCCAGGTTAAGGGCCAC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSRGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34044 or 37848
Size: 1 bp or 1 bp
Located at: α1 or α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Japanese, French Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
599Hb Aichiα1 or α2D-10Dual Kit Program21.94.05Heterozygous. Elutes as HbS. [PDF]
600Hb Aichiα1 or α2VARIANTβ-thal Short Program19.74.17Heterozygous. Elutes as HbS. [PDF]
601Hb Aichiα1 or α2VARIANT IIβ-thal Short Program21.14.33Heterozygous. Elutes as HbS. [PDF]
602Hb Aichiα1 or α2VARIANT IIDual Kit Program22.53.465Heterozygous. Elutes as HbS. [PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Harano T, Harano K, Shibata S, Ueda S, Mori H, Seki M, Hemoglobin Aichi [alpha 50(CE8) His----Arg]: a new slightly unstable hemoglobin variant discovered in Japan., FEBS Lett. , 169(2), 297-9, 1984 PubMed
  2. Baudin V, Baklouti F, Wajcman H, Delaunay J, Hemoglobin Aichi [alpha 50(CE8)His----Arg] in a French Caucasian patient., Hemoglobin, 11(2), 145-9, 1987 PubMed
Created on 2010-06-16 16:13:15, Last reviewed on 2022-05-11 11:00:15 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.