IthaID: 570
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | Pathogenic / Likely Pathogenic |
|---|---|---|---|
| Common Name: | CD 58 CAC>TAC [His>Tyr] | HGVS Name: | HBA2:c.175C>T |
| Hb Name: | Hb M-Boston | Protein Info: | α2 58(E7) His>Tyr |
| Also known as: | Hb M-Gothenburg, Hb M-Kiskunhalas, Hb M-Norin, Hb M-Osaka |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
CCACGGCTCTGCCCAGGTTAAGGGC [C/T] ACGGCAAGAAGGTGGCCGACGCGCT (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGYGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy |
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant |
| Allele Phenotype: | Methemoglobinaemia |
| Stability: | N/A |
| Oxygen Affinity: | Decreased Oxygen Affinity |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 16 |
|---|---|
| Locus: | NG_000006.1 |
| Locus Location: | 34067 |
| Size: | 1 bp |
| Located at: | α2 |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Substitution) |
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
| Ethnic Origin: | German, Swedish, Dutch, Hungarian, Japanese |
| Molecular mechanism: | Altered heme pocket |
| Inheritance: | Recessive |
| DNA Sequence Determined: | No |
In silico pathogenicity prediction
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Pulsinelli PD, Perutz MF, Nagel RL, Structure of hemoglobin M Boston, a variant with a five-coordinated ferric heme., Proc. Natl. Acad. Sci. U.S.A. , 70(12), 3870-4, 1973 PubMed
- Nishikura K, Sugita Y, Nagai M, Yoneyama Y, Jagenburg R, High cooperativity of haemoglobin M Boston in the completely reduced state., Nature , 254(5502), 727-8, 1975 PubMed
- Takahashi S, Lin AK, Ho C, Proton nuclear magnetic resonance studies of hemoglobins M Boston (alpha 58E7 His leads to Tyr) and M Milwaukee (beta 67E11 Val leads to Glu): spectral assignments of hyperfine-shifted proton resonances and of proximal histidine (E7) NH resonances to the alpha and beta chains of normal human adult hemoglobin., Biochemistry , 19(23), 5196-202, 1980 PubMed
- Shin C, Hong M, Kim M, Lee JH, Exon sequencing of the alpha-2-globin gene for the differential diagnosis of central cyanosis in newborns: a case report., BMC Pediatr, 19(1), 221, 2019 PubMed
Created on 2010-06-16 16:13:15,
Last reviewed on 2021-05-12 15:36:33 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.