IthaID: 628



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 79 GCG>GGG [Ala>Gly] HGVS Name: HBA2:c.239C>G
Hb Name: Hb J-Singapore Protein Info: α2 79(EF8) Ala>Gly

Context nucleotide sequence:
GTGCAGGTCGCTCAGGGCGGACAGC [C/G] CGTTGGGCATGTCGTCCACGTGCGC (Strand: -)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNGLSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as:

Comments: Rare, fast moving variant comprising two amino acid substitutions; asparagine to aspartic acid at position α78 (α78(EF7)Asn>Asp) and alanine to glycine at position α79 (α79(EF8)Ala>Gly). The absence of DNA evidence for the α78 (Asn>Asp) substitution means that the deamidation happens at the protein level. On CE electrophoregram, Hb J-Singapore presents in the same migration time of Hb J-Buda and Hb Bart’s (γ4). The HPLC patterns of Hb J-Singapore and Hb J-Buda are similar. Initially reported in a Malaysian family (n 4) living in Singapore [PMID: 5085670], as well as in a Thai pregnant woman during antenatal screening [J Med Assoc Thai 2018; 101 (2): 275-8]; heterozygotes are asymptomatic.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34131
Size: 1 bp
Located at: α2
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Malay, Thai
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Blackwell RQ, Boon WH, Liu CS, Weng MI, Hemoglobin J Singapore: alpha 78 Asn--Asp; alpha 79 Ala--Gly., Biochim. Biophys. Acta , 278(3), 482-90, 1972 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2022-12-12 14:26:33 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.