IthaID: 678

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 94 GAC>GGC [Asp>Gly] HGVS Name: HBA1:c.284A>G
Hb Name: Hb Çapa Protein Info: α1 94(G1) Asp>Gly
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTGCACGCGCACAAGCTTCGGGTGG [A/C/G] CCCGGTCAACTTCAAGGTGAGCGGC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVGPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Decreased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37980
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Turkish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Dinçol G, Dinçol K, Erdem S, Pobedimskaya DD, Molchanova TP, Ye Z, Webber BB, Wilson JB, Huisman TH, Hb Capa or alpha (2)94(G1)Asp-->Gly beta 2, a mildly unstable variant with an A-->G (GAC-->GGC) mutation in codon 94 of the alpha 1-globin gene., Hemoglobin , 18(1), 57-60, 1994
Created on 2010-06-16 16:13:16, Last reviewed on 2014-04-14 13:05:34 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.