
IthaID: 739
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A | 
|---|---|---|---|
| Common Name: | CD 126 GAC>TΑC [Asp>Tyr] | HGVS Name: | HBA1:c.379G>T | 
| Hb Name: | Hb Montefiore | Protein Info: | α1 126(H9) Asp>Tyr | 
| Also known as: | 
We follow the 
						 
							HGVS sequence variant nomenclature
						
						and
						 
							 IUPAC standards.
						
					
					
					
Context nucleotide sequence:
CACCCCTGCGGTGCACGCCTCCCTG [G/T] ACAAGTTCCTGGCTTCTGTGAGCAC  (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLYKFLASVSTVLTSKYR
Phenotype
| Hemoglobinopathy Group: | Structural Haemoglobinopathy | 
|---|---|
| Hemoglobinopathy Subgroup: | α-chain variant | 
| Allele Phenotype: | N/A | 
| Stability: | N/A | 
| Oxygen Affinity: | Increased Oxygen Affinity | 
| Associated Phenotypes: | N/A | 
Location
| Chromosome: | 16 | 
|---|---|
| Locus: | NG_000006.1 | 
| Locus Location: | 38224 | 
| Size: | 1 bp | 
| Located at: | α1, α1 or α2 | 
| Specific Location: | Exon 3 | 
Other details
| Type of Mutation: | Point-Mutation(Substitution) | 
|---|---|
| Effect on Gene/Protein Function: | Missense codons (Protein Structure) | 
| Ethnic Origin: | Puerto Rican | 
| Molecular mechanism: | N/A | 
| Inheritance: | Recessive | 
| DNA Sequence Determined: | Yes | 
In silico pathogenicity prediction
Publications / Origin
- Wajcman H, Kister J, Galactéros F, Spielvogel A, Lin MJ, Vidugiris GJ, Hirsch RE, Friedman JM, Nagel RL, Hb Montefiore (126(H9)Asp-->Tyr). High oxygen affinity and loss of cooperativity secondary to C-terminal disruption., J. Biol. Chem. , 271(38), 22990-8, 1996
- Zhou X, Chen T, Zhang Q, Qi M, Zhang L, Du J, Chi H, Shen B, Xu X, Lu Y, De novo HBB frameshift mutation in a patient with dominant β-thalassemia major., Int J Lab Hematol, 44(1), e21-e25, 2022
					Created on 2010-06-16 16:13:16,
					Last reviewed on 2022-03-02 09:50:23					(Show full history)
				
				
			
 Disclaimer: The information on this website is provided as an information resource only
    and must not to be used as a substitute for professional diagnosis and treatment.
    The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
    diagnosis or any other information, services or products that an individual obtains through this website.