
IthaID: 783
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
---|---|---|---|
Common Name: | CD 141 CGT>CAT [Arg>His] | HGVS Name: | NM_000558.3(HBA1):c.425G>A |
Hb Name: | Hb Suresnes | Protein Info: | α1 141(HC3) Arg>His |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
AGCACCGTGCTGACCTCCAAATACC [G/A] TTAAGCTGGAGCCTCGGTGGCCATG (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYH
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | Increased Oxygen Affinity |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 38270 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | African, French |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | No |
In silico pathogenicity prediction
Publications / Origin
- Poyart C, Krishnamoorthy R, Bursaux E, Gacon G, Labie D, Structural and functional studies of haemoglobin Suresnes or alpha2 141 (HC3) Arg replaced by His beta2, a new high oxygen affinity mutant., FEBS Lett. , 69(1), 103-7, 1976
- Gravely ME, Harris HF, Stallings M, Lam H, Wilson JB, Huisman TH, Hb Suresnes or alpha2 141(HC3) ArgyieldHis beta2 in a black family., Hemoglobin , 2(2), 187-9, 1978
- Poyart C, Bursaux E, Arnone A, Bonaventura J, Bonaventura C, Structural and functional studies of hemoglobin Suresnes (arg 141 alpha 2 replaced by His beta 2). Consequences of disrupting an oxygen-linked anion-binding site., J. Biol. Chem. , 255(19), 9465-73, 1980
Created on 2010-06-16 16:13:16,
Last reviewed on 2024-04-12 11:51:06 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.