IthaID: 857



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 17 AAG>CAG HGVS Name: HBB:c.52A>C
Hb Name: Hb Nikosia Protein Info: β 17(A14) Lys>Gln
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTCTGCCGTTACTGCCCTGTGGGGC [A/C] AGGTGAACGTGGATGAAGTTGGTGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGQVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Comments: Hb Nicosia is a β-globin variant identified by peptide mapping and sequencing, revealing a β17 (A14) Lys>Gln substitution. This should not be confused with Hb Nikosia [PMID: 14282069], an α-globin variant characterized using protein-based methods and hybridization studies, for which no peptide or DNA analysis was performed to define the exact nucleotide change.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70646
Size: 1 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Cypriot
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Spivak VA, Some abnormal hemoglobin identifications in the U.S.S.R. by micropreparative thin layer peptide mapping., Hemoglobin, 13(2), 219-20, 1989 PubMed
  2. Kyrri AR, Felekis X, Kalogerou E, Wild BJ, Kythreotis L, Phylactides M, Kleanthous M, Hemoglobin variants in Cyprus., Hemoglobin, 33(2), 81-94, 2009 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2026-04-16 08:09:02 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.