IthaID: 1008
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 63 CAT>AAT [His>Asn] | HGVS Name: | HBB:c.190C>A |
Hb Name: | Hb Haná | Protein Info: | β 63(E7) His>Asn |
Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
TATGGGCAACCCTAAGGTGAAGGCT [C>A] ATGGCAAGAAAGTGCTCGGTGCCTT (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKANGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
Comments: The mutation replaces a hydrophobic amino acid (His) for a hydrophilic amino acid (Asn), likely affecting the hydrophobic properties of the heme microenvironment. Initially reported in a heterozygous state in a Czech proband and her sister with Heinz body hemolytic anemia and elevated levels of methaemoglobin. The mother with the same mutation, who is also a smoker, is asymptomatic and had no anemia nor signs of hemolysis. Also found in a heterozygous state in a Senegalese proband and her mother, both presenting with chronic asthenia associated with intermittent headaches, moderate anemia and elevated levels of methaemoglobin. Due to the proband's dark skin, cyanosis was not clinically detectable.
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | β-chain variant |
Allele Phenotype: | Methemoglobinaemia |
Stability: | Unstable |
Oxygen Affinity: | N/A |
Associated Phenotypes: | Haemolytic anaemia [HP:0001878] |
Location
Chromosome: | 11 |
---|---|
Locus: | NG_000007.3 |
Locus Location: | 70914 |
Size: | 1 bp |
Located at: | β |
Specific Location: | Exon 2 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | N/A |
Ethnic Origin: | Czech, Senegalese |
Molecular mechanism: | Altered heme pocket |
Inheritance: | Dominant |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Sequence Viewer
Publications / Origin
- Divoký V, Luhový M, Divoká M, Melichárková R, Pospísilová , Indrák K, [Hemoglobin Haná or alpha 2 beta 2 63 (E7) His-Asn: a new unstable hemoglobin variant with a paradoxically different clinical manifestations in smokers and non-smokers in the same family], Vnitr̆ní lékar̆ství, 43(5), 267-72, 1997 PubMed
- Mojzikova R, Dolezel P, Pavlicek J, Mlejnek P, Pospisilova D, Divoky V, Partial glutathione reductase deficiency as a cause of diverse clinical manifestations in a family with unstable hemoglobin (Hemoglobin Haná, β63(E7) His-Asn)., Blood Cells Mol Dis, 45(3), 219-22, 2010 PubMed
- Le Calvez B, Delecourt-Billet M, Grain A, Couque N, Leblanc T, Congenital methaemoglobinaemia and chronic haemolysis related to a rare form of unstable haemoglobin: Efficacy of riboflavin on clinical and biological features., Br J Haematol, 2022 PubMed