IthaID: 1050



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 75 CTG>CCG; CD 141 (-CTG) HGVS Name: HBB:c.[227T>C;424_426delCTG]
Hb Name: Hb Atlanta-Coventry Protein Info: β 75(E19) Leu>Pro AND β 141(H19) Leu->0

Context nucleotide sequence:
AGTGGTGGCTGGTGTGGCTAATGCC [-/CTG] GCCCACAAGTATCACTAAGCTCGCT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGPAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Hb Atlanta-Coventry (βAt-Co) was initially proposed to contain two mutations, β75 Leu>Pro (Hb Atlanta) and β141 Leu deleted (Hb Coventry). It is now proposed that β141 Leu is not deleted but it is likely to be a hydroxyleucine, which results from the post-translational oxidation of β141 Leu as a consequence of perturbation of the haem environment caused by the β75 Leu>Pro mutation in the E helix (E19).

External Links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70951
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: N/A
Ethnic Origin: N/A
Molecular mechanism: Altered secondary structure
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Brennan SO, Shaw J, Allen J, George PM, Beta 141 Leu is not deleted in the unstable haemoglobin Atlanta-Coventry but is replaced by a novel amino acid of mass 129 daltons., British journal of haematology, 81(1), 99-103, 1992 PubMed
  2. Brennan SO, Shaw JG, George PM, Huisman TH, Posttranslational modification of beta 141 Leu associated with the beta 75(E19)Leu-->Pro mutation in Hb Atlanta., Hemoglobin, 17(1), 1-7, 1993 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2021-11-29 16:48:52 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.