IthaID: 1068

Names and Sequences

Functionality:	Globin gene causative mutation
Common Name:	CD 80 AAC>AAA or AAG	HGVS Name:	HBB:c.243C>A \| HBB:c.243C>G
Hb Name:	Hb G-Szuhu	Protein Info:	β 80(EF4) Asn>Lys

Context nucleotide sequence:
GTGATGGCCTGGCTCACCTGGACAA [A/C/G] CTCAAGGGCACCTTTGCCACACTGA (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDKLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as: Hb Gifu

External Links

HbVar	dbSNP
OMIM	SwissVar

Location

Chromosome:	11
Locus:	NG_000007.3
Locus Location:	70967
Size:	1 bp
Located at:	β
Specific Location:	Exon 2

Phenotype

Hemoglobinopathy Group:	Structural Haemoglobinopathy
Hemoglobinopathy Subgroup:	β-chain variant
Allele Phenotype:	N/A
Stability:	N/A
Oxygen Affinity:	N/A
Associated Phenotypes:	N/A

Other details

Type of Mutation:	Point-Mutation(Substitution)
Effect on Gene/Protein Function:	N/A
Ethnic Origin:	Chinese \| English \| Japanese \| Jewish \| Sicilian \| Spanish
Inheritance:	Recessive
DNA Sequence Determined:	No
Detection Methods:	Direct DNA sequencing

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.

ID	Hb Variant	Gene	Instrument	Method	Area (%)	Ret Time (min)	Comments
199	Hb G-Szuhu	β	D-10	Dual Kit Program	32.2	4.17	Clinically normal. Elutes in HbS window.	[PDF]
202	Hb G-Szuhu	β	VARIANT II	Dual Kit Program	3.2	3.017		[PDF]
200	Hb G-Szuhu	β	VARIANT	β-thal Short Program	37.7	4.54	Clinically normal.	[PDF]
201	Hb G-Szuhu	β	VARIANT II	β-thal Short Program	34.5	2.13		[PDF]

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

Blackwell RQ, Yang HJ, Wang CC, Hemoglobin G Szuhu: beta80 Asn replaced by Lys., Biochimica et biophysica acta, 188(1), 59-64, 1969 PubMed
Matsutomo K, Miyaji T, Iuchi I, Ueda S, Shibata S, Hb Gifu (beta 80 Asn-Lys), a new slow moving hemoglobin detected from two families of Japanese., Nippon Ketsueki Gakkai Zasshi , 34(4), 479-83, 1971 PubMed
Kaufman S, Leiba H, Clejan L, Wallis K, Lorkin PA, Lehmann H, Haemoglobin G-Szuhu, beta80 Asn-Lys, in the homozygous state in a patient with abetalipoproteinaemia., Hum. Hered. , 25(1), 60-8, 1975 PubMed
Schillirò G, Russo-Mancuso G, Dibenedetto SP, Samperi P, di Cataldo A, Ragusa R, Testa R, Six rare hemoglobin variants found in Sicily., Hemoglobin, 15(5), 431-7, 1991 PubMed

Created on 2010-06-16 16:13:16, Last reviewed on 2017-04-11 12:01:51 (Show full history)

A/A	Date	Curator(s)	Comments
1	2010-06-16 16:13:16	The IthaGenes Curation Team	Created
2	2013-10-15 17:00:14	The IthaGenes Curation Team	Reviewed.
3	2017-04-11 12:01:51	The IthaGenes Curation Team	Reviewed. Mutation Names/DNA Info added. References added.

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.