IthaID: 2315
Names and Sequences
Functionality: | Globin gene causative mutation | Pathogenicity: | Variant of Uncertain Significance |
---|---|---|---|
Common Name: | CD 110 GCC>GTC [Ala>Val] | HGVS Name: | HBA1:c.332C>T |
Hb Name: | Hb Montluel | Protein Info: | α1 110(G17) Ala>Val |
Context nucleotide sequence:
AGCCACTGCCTGCTGGTGACCCTGG [C/T] CGCCCACCTCCCCGCCGAGTTCACC (Strand: +)
Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLVAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Also known as: Hb White Rose
Comments: Found in a 75-year-old French Caucasian male suffering from Waldenstrom disease presented with Hb 10 g/dL, MCV 94 fL, MCH 32.3 pg. HPLC analysis shown normal levels of Hb A2 2.5 %, Hb F 0.5 % and an abnormal peak of 14.5 %. Hb White Rose is the corresponding HBA1 or HBA2 variant (first report).
Phenotype
Hemoglobinopathy Group: | Structural Haemoglobinopathy |
---|---|
Hemoglobinopathy Subgroup: | α-chain variant |
Allele Phenotype: | N/A |
Stability: | N/A |
Oxygen Affinity: | N/A |
Associated Phenotypes: | N/A |
Location
Chromosome: | 16 |
---|---|
Locus: | NG_000006.1 |
Locus Location: | 38177 |
Size: | 1 bp |
Located at: | α1 |
Specific Location: | Exon 3 |
Other details
Type of Mutation: | Point-Mutation(Substitution) |
---|---|
Effect on Gene/Protein Function: | Missense codons (Protein Structure) |
Ethnic Origin: | British, French Caucasian |
Molecular mechanism: | N/A |
Inheritance: | Recessive |
DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Note:
The impact thresholds provided in this section are based on the analyses performed in Tamana et.al. For any given tool, the impact thresholds defined for the set of variants with the same effect on function as the variant examined, are preferred over those defined for the full dataset.
Sequence Viewer
Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI.
Therefore, IthaGenes has no responsibility over any temporary unavailability of the service.
In such a case, please Refresh the page or retry at a later stage.
Otherwise, use this external link.
Publications / Origin
- Renoux C, Feray C, Joly P, Lacan P, Francina A, Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C]., Hemoglobin, 39(3), 147-51, 2015 PubMed
Created on 2014-01-10 13:59:52,
Last reviewed on 2021-03-16 09:14:36 (Show full history)
A/A | Date | Curator(s) | Comments |
---|---|---|---|
1 | 2014-01-10 13:59:52 | The IthaGenes Curation Team | Created |
2 | 2014-01-10 13:59:52 | The IthaGenes Curation Team | Reviewed. |
3 | 2014-05-23 09:42:58 | The IthaGenes Curation Team | Reviewed. Synonym, comment and additional location and links added. |
4 | 2021-03-16 09:14:36 | The IthaGenes Curation Team | Reviewed. HGVS, Hb and protein name corrected. Comment added. |
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.
IthaGenes was last updated on 2023-03-22 16:46:31