IthaID: 2358



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Variant of Uncertain Significance
Common Name: CD 71 GCG>GTG [Ala>Val] HGVS Name: HBA1:c.215C>T
Hb Name: Hb Allison Park Protein Info: α1 71(E20) Ala>Val
Also known as: Hb Ozieri

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GCCGACGCGCTGACCAACGCCGTGG [C>T] GCACGTGGACGACATGCCCAACGCG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVVHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Initially reported as a silent Hb variant in five apparently unrelated newborn babies in Sardinia. It was detected by IEF and characterized by protein analysis as an Ala>Val change at position 71 of α-chain (α1 or α2). It was named Hb Ozieri. This substitution indicates a C to T transition in the GCG codon for Ala which contains one of the 35 unmethylated CpG dinucleotides of the α-globin gene. A later entry in a public database reports a cod71 GCG>GTG change in the α1 gene with the Hb variant named Hb Allison Park.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37911
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Ferranti P, Parlapiano A, Malorni A, Pucci P, Marino G, Cossu G, Manca L, Masala B, Hemoglobin Ozieri: a new alpha-chain variant (alpha 71(E20)Ala-->Val). Characterization using FAB- and electrospray-mass spectrometric techniques., Biochim. Biophys. Acta , 1162(1), 203-8, 1993 PubMed
Created on 2014-05-23 11:26:19, Last reviewed on 2023-04-28 10:18:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.