IthaID: 3700



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 34 GTC>GCC [Val>Ala] HGVS Name: HBB:c.104T>C
Hb Name: Hb San Francisco-KP Protein Info: β 34(B16) Val>Ala

Context nucleotide sequence:
CTATTTTCCCACCCTTAGGCTGCTGGTGG [T/C] CTACCCTTGGACCCAGAGGTTCTTTGAGT (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVPYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH

Also known as:

Comments: Found in a 71-year-old male of French and Polish ancestry presented with long-standing history of polycythemia.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: β-thalassaemia, β-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70828
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: French-Polish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Tavakoli J, Ho G, Kavecansky J, Pai AP, A New High Affinity Hemoglobin Variant: Hb San Francisco-KP (: c.104T>C)., Hemoglobin, 45(3), 154-156, 2021 PubMed
Created on 2020-11-15 21:22:00, Last reviewed on 2021-10-12 16:20:24 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.