IthaID: 3864



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 116 GAG>TAG [Glu>Stop] HGVS Name: HBA1:c.349G>T
Hb Name: N/A Protein Info: α1 116(GH4) Glu>STOP

Context nucleotide sequence:
GACCCTGGCCGCCCACCTCCCCGCC [G>T] AGTTCACCCCTGCGGTGCACGCCTC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAX

Also known as:

Comments: Found in a newborn through a thalassaemia screening program performing genetic testing by next-generation sequencing and gap-polymerase chain reaction. At 2-year-old the proband presented with abnormal hematological indices.

We follow the HGVS sequence variant nomenclature and IUPAC standards.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: α-thalassaemia
Allele Phenotype:α⁺
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 38194
Size: 1 bp
Located at: α1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Nonsense codon (Translation)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Yin Z, Hao Y, Huang X, Chen X, Chen S, Li G, Chen C, Wei F, A Novel Mutation at HBA1:c.349G>T Causing α-Thalassemia in a Chinese Family., Hemoglobin, 45(2), 94-96, 2021 PubMed
Created on 2021-09-30 08:40:16, Last reviewed on 2022-08-24 09:28:04 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.