
IthaID: 4150
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 122/123 (+A) | HGVS Name: | HBD:c.369_370insA |
| Hb Name: | N/A | Protein Info: | N/A |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
TGCTGGCCCGCAACTTTGGCAAGGAATTC [-/A] ACCCCACAAATGCAGGCTGCCTATCAGAA (Strand: -)
Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFNPTNAGCLSEGGGWCGX
Comments: Identified in a 41-year-old Chinese male presented with normal haematological parameters and a low Hb A₂ level (1.5%). The T nucleotide insertion results in a frameshift, introducing a premature stop codon seventeen amino acids downstream in the altered reading frame. This likely leads to the production of an aberrant and unstable truncated protein, potentially subject to nonsense-mediated decay.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Thalassaemia |
|---|---|
| Hemoglobinopathy Subgroup: | δ-thalassaemia |
| Allele Phenotype: | δ0 |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 64577 |
| Size: | 1 bp |
| Located at: | δ |
| Specific Location: | Exon 3 |
Other details
| Type of Mutation: | Point-Mutation(Insertion) |
|---|---|
| Effect on Gene/Protein Function: | Frameshift (Translation) |
| Ethnic Origin: | Chinese |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Li Y, Ye L, Liang L, Zheng L, Xiao Y, Lao Z, Bai J, He X, Fang Q, Qin T, Unveiling the molecular landscape of δ-thalassemia and δ-globin variants in southern China: novel mutations, gene spectrum, and implications for thalassemia diagnosis., Front Genet, 16(0), 1584310, 2025
Microattributions
| A/A | Contributor(s) | Date | Comments |
|---|---|---|---|
| 1 | Li, Youqiong | 2024-08-11 | First report. |