IthaID: 4150

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 122/123 (+A) HGVS Name: HBD:c.369_370insA
Hb Name: N/A Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TGCTGGCCCGCAACTTTGGCAAGGAATTC [-/A] ACCCCACAAATGCAGGCTGCCTATCAGAA (Strand: -)

Protein sequence:
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFNPTNAGCLSEGGGWCGX

Comments: Identified in a 41-year-old Chinese male presented with normal haematological parameters and a low Hb A₂ level (1.5%). The T nucleotide insertion results in a frameshift, introducing a premature stop codon seventeen amino acids downstream in the altered reading frame. This likely leads to the production of an aberrant and unstable truncated protein, potentially subject to nonsense-mediated decay.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: δ-thalassaemia
Allele Phenotype:δ0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 64577
Size: 1 bp
Located at: δ
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Insertion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Chinese
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Li Y, Ye L, Liang L, Zheng L, Xiao Y, Lao Z, Bai J, He X, Fang Q, Qin T, Unveiling the molecular landscape of δ-thalassemia and δ-globin variants in southern China: novel mutations, gene spectrum, and implications for thalassemia diagnosis., Front Genet, 16(0), 1584310, 2025

Microattributions

A/AContributor(s)DateComments
1Li, Youqiong2024-08-11First report.
Created on 2025-06-25 10:02:30, Last reviewed on 2025-11-24 09:36:06 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.