IthaID: 690



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 99 AAG>GAG [Lys>Glu] HGVS Name: HBA1:c.298A>G
Hb Name: Hb Turriff Protein Info: α1 99(G6) Lys>Glu

Context nucleotide sequence:
GCTTCGGGTGGACCCGGTCAACTTC [A/G] AGGTGAGCGGCGGGCCGGGAGCGAT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFELLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Also known as: Hb Turriff-I

Comments: The lysine residue at α99(G6) is in the central cavity of the haemoglobin tetramer, situated in the region of the α1β1 contact. The Lys>Glu replacement does not appear to impair β-chain interactions. It disrupts AHSP binding, hence variant may be mildly destabilizing. Initially reported as a de novo mutation (α1 or α2) in a Scottish person during HbA1c screening (22% of the total Hb). Reported as an α1 globin gene mutation in a Japanese person with a high HbA1 level, hence called Hb Turriff-I (10.5% of the total Hb). Variant was not associated with any haematological disturbance. Normal isopropanol stability test.

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37994
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Scottish, Japanese
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Langdown JV, Davidson RJ, Williamson D, A new alpha chain variant, Hb Turriff [alpha 99(G6)Lys----Glu]: the interference of abnormal hemoglobins in Hb A1c determination., Hemoglobin , 16(1), 11-7, 1992 PubMed
  2. Harano T, Harano K, Hong YF, Than AM, Suetsugu Y, Ohba K, The mutation of Hb Turriff [alpha99(G6)Lys --> Glu (AAG --> GAG)] is carried by the alpha1-globin gene in a Japanese (Hb Turriff-I)., Hemoglobin, 27(2), 123-7, 2003 PubMed
  3. Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2021-04-07 12:21:29 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.