IthaID: 708



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 112 CAC>GAC [His>Asp] HGVS Name: NM_000558.5(HBA1):c.337C>G
Hb Name: Hb Hopkins-II Protein Info: α1 112(G19) His>Asp
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTGCCTGCTGGTGACCCTGGCCGCC [C/G] ACCTCCCCGCCGAGTTCACCCCTGC (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAADLPAEFTPAVHASLDKFLASVSTVLTSKYR

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: Increased Oxygen Affinity
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 38182
Size: 1 bp
Located at: α1
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Caucasian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

HPLC

Disclaimer: The HPLC images are provided as an information resource only. Bio-Rad Laboratories, Inc and the ITHANET Portal disclaim responsibility and have no liability if this information is used for diagnostic or treatment purposes. D-10™ and VARIANT™ are registered trademarks of Bio-Rad Laboratories, Inc. and used with permission. Redistribution and use of the above material is allowed only with permission by Bio-Rad Laboratories, Inc. To access HPLC images and reports for different variants, use the IthaChrom tool.
ID Hb Variant Gene Instrument Method Area (%) Ret Time (min) Comments
347 Hb Hopkins-II α1 D-10 Dual Kit Program 21.4 1.39 Heterozygote. [PDF]
277 Hb Hopkins-II α1 D-10 Dual Kit Program 18.3 1.41 heterozygote [PDF]
348 Hb Hopkins-II α1 VARIANT β-thal Short Program 12.5 1.46 Heterozygote. [PDF]
278 Hb Hopkins-II α1 VARIANT β-thal Short Program 19.3 1.5 heterozygote [PDF]
350 Hb Hopkins-II α1 VARIANT II Dual Kit Program 22.6 1.49 Heterozygote. [PDF]
349 Hb Hopkins-II α1 VARIANT II β-thal Short Program 10.3 1.6 Heterozygote. [PDF]
280 Hb Hopkins-II α1 VARIANT II Dual Kit Program 19.5 1.5 heterozygote [PDF]
279 Hb Hopkins-II α1 VARIANT II β-thal Short Program 19 1.51 heterozygote [PDF]

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Charache S, Ostertag W, von Ehrenstein G, Clinical studies and physiological properties of Hopkins-2 haemoglobin., Nature New Biol. , 234(51), 248-51, 1971 PubMed
  2. Clegg JB, Charache S, The structure of hemoglobin Hopkins-2., Hemoglobin , 2(1), 85-8, 1978 PubMed
  3. Henderson SJ, Timbs AT, McCarthy J, Gallienne AE, Proven M, Rugless MJ, Lopez H, Eglinton J, Dziedzic D, Beardsall M, Khalil MS, Old JM, Ten Years of Routine α- and β-Globin Gene Sequencing in UK Hemoglobinopathy Referrals Reveals 60 Novel Mutations., Hemoglobin , 40(2), 75-84, 2016 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2024-04-12 10:36:33 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.