IthaID: 779



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Benign / Likely Benign
Common Name: CD 141 CGT>GGT [Arg>Gly] HGVS Name: HBA2:c.424C>G
Hb Name: Hb J-Camagüey Protein Info: α2 141(HC3) Arg>Gly

Context nucleotide sequence:
GAGCACCGTGCTGACCTCCAAATAC [C/G] GTTAAGCTGGAGCCTCGGTAGCCGT (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYG

Also known as:

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Unstable
Oxygen Affinity: N/A
Associated Phenotypes: N/A

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34458
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Australian, Chinese, Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Martinez G, Lima F, Residenti C, Colombo B, Hb J Camaguey alpha 2 141(HC3) Arg replaced by Gly beta 2: a new abnormal human hemoglobin., Hemoglobin , 2(1), 47-52, 1978 PubMed
  2. Xiong F, Yang KG, Liang CC, Huang YW, Wang RX, Zhang NJ, A case of Hb J-Camaguey or alpha 2141(HC3)Arg----Gly beta 2 in a Chinese family., Hemoglobin , 8(4), 397-9, 1984 PubMed
  3. Brennan SO, Lowrey IR, Harris MG, Rodwell R, Zarkos K, Wilkinson T, Yakas J, Kronenberg H, Hb J-Camaguey [alpha 141(HC3)Arg----Gly] associated with alpha-thalassemia-1 in an Australian family., Hemoglobin , 15(4), 303-7, 1991 PubMed
  4. Romero MJ, Garrido ML, Abril E, Garrido F, de Pablos JM, Detection of Hb J-Camagüey [alpha 141(HC3)Arg-->Gly] in three Spanish families., Hemoglobin , 19(5), 287-9, 1995 PubMed
  5. de la Fuente-Gonzalo F, Sala F, Ropero P, González FA, [First world case of -α3,7-associated Hb J-Camagüey]., Med Clin (Barc), 138(9), 412-3, 2012 PubMed
Created on 2010-06-16 16:13:16, Last reviewed on 2021-04-07 12:53:17 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.