IthaID: 2023



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 117 TTC>TCC [Phe>Ser] HGVS Name: HBA2:c.353T>C
Hb Name: Hb Foggia Protein Info: α2 117(GH5) Phe>Ser
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAESTPAVHASLDKFLASVSTVLTSKYR

Comments: Replacement of Phe residue at position α117 (GH5) by a charged arginine residue, which disrturbs the α1β1 contact and also impairs interaction with AHSP, thus leading to the α chain pool reduction and to the α-thalassemia phenotype. No unstable haemoglobins and no erythrocyte inclusion bodies have been documented. Detected in a family from Foggia, Southern Italy, with α-thalassemia haematologic phenotype (microcythemia).

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia and Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-thalassaemia, α-chain variant
Allele Phenotype:α⁺
Thalassaemia
Stability: N/A
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 34387
Size: 1 bp
Located at: α2
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Italian
Molecular mechanism: Altered α1β1 interface
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Lacerra G, Scarano C, Musollino G, Flagiello A, Pucci P, Carestia C., Hb Foggia or alpha 117(GH5)Phe -> Ser: a new alpha 2 globin allele affecting the alpha Hb-AHSP interaction., Haematologia, 93(1), 141-2, 2008 PubMed
  2. Thom CS, Dickson CF, Gell DA, Weiss MJ, Hemoglobin variants: biochemical properties and clinical correlates., Cold Spring Harb Perspect Med, 3(3), a011858, 2013 PubMed
Created on 2010-10-16 11:51:11, Last reviewed on 2019-06-20 16:40:29 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.