IthaID: 3557



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 43 TTC>CTC [Phe>Leu] HGVS Name: HBA1:c.130T>C
Hb Name: Hb Vanvitelli Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTCCTTCCCCACCACCAAGACCTAC [T>C] TCCCGCACTTCGACCTGAGCCACGG (Strand: +)

Protein sequence:
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYLPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Comments: Detected in a 14-year-old female presenting with haemolytic anaemia and hepatosplenomegaly. Co-inherited with the deletion -α3.7. Father was carrier for the variant, while none of her two siblings displayed any mutation in the α-globin genes. Asymptomatic in the heterozygous state with mild reticulocytosis and normal Hb value. The variant was characterized by HPLC and mass spectroscopy. Laboratory tests confirmed low oxygen saturation (SpO2) at the pulse oximetry (86-88%). The CD43 Phe residue is found at the CD1 helical region in the heme pocket and is critical in maintaining the heme in the proper position for interaction with globin chains.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Structural Haemoglobinopathy
Hemoglobinopathy Subgroup: α-chain variant
Allele Phenotype:N/A
Stability: Hyperunstable
Oxygen Affinity: N/A
Associated Phenotypes: Haemolytic anaemia [HP:0001878]

Location

Chromosome: 16
Locus: NG_000006.1
Locus Location: 37826
Size: 1 bp
Located at: α1
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Substitution)
Effect on Gene/Protein Function: Missense codons (Protein Structure)
Ethnic Origin: Italian
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Casale M, Cozzolino F, Scianguetta S, Pucci P, Monaco V, Sanchez G, Santoro C, Rubino R, Cannata M, Perrotta S, Hb Vanvitelli: A new unstable α-globin chain variant causes undiagnosed chronic haemolytic anaemia when co-inherited with deletion - α., Clin. Biochem., 74(0), 80-85, 2019 PubMed
Created on 2020-01-17 09:25:06, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.