IthaID: 3846

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 118 (-TT) HGVS Name: HBB:c.356_357delTT
Hb Name: N/A Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
CTGGTCTGTGTGCTGGCCCATCACT [TT/-] GGCAAAGAATTCACCCCACCAGTGC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHWQRIHPTSAGCLSESGGWCGX

Comments: : Found in a 5-month-old female presented with severe congenital anaemia (Hb 5.9 g/dL, RBC 3.17×10^12/L) and moderate microcytosis (MCV 60.5 fL) and hypochromia (MCH 18.8 pg). The patient had transfusion-dependent β0-thalassaemia. The 2bp deletion, causing a frameshift that introduces a premature stop codon twenty amino acids further down the new reading frame.

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71930
Size: 2 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Iraqi Kurd
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

  1. Atroshi SD, Al-Allawi N, Chui DHK, Najmabadi H, Khailany RA, A Novel β-Thalassemia Mutation, : c.356_357delTT [Codon 118 (-TT)] in an Iraqi Kurd., Hemoglobin, 45(3), 212-214, 2021
Created on 2021-08-23 12:34:58, Last reviewed on 2022-08-24 11:18:45 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.