
IthaID: 3888
Names and Sequences
| Functionality: | Globin gene causative mutation | Pathogenicity: | N/A |
|---|---|---|---|
| Common Name: | CD 97/98 (+GCAC) | HGVS Name: | HBB:c.291_294dup |
| Hb Name: | N/A | Protein Info: | N/A |
| Also known as: |
We follow the
HGVS sequence variant nomenclature
and
IUPAC standards.
Context nucleotide sequence:
GAGCTGCACTGTGACAAGCTGCAC [-/GCAC] GTGGATCCTGAGAACTTCAGGGTG (Strand: -)
Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHARGS*
Comments: Found in a mother with a history of transfusion-dependent thalassemia and also in her child presented with anemia and clinical data of thalassemia. The 4 bp insertion (GCAC), causes a frameshift that introduces a premature stop codon four amino acids further down the new reading frame.
External Links
No available links
Phenotype
| Hemoglobinopathy Group: | Thalassaemia |
|---|---|
| Hemoglobinopathy Subgroup: | β-thalassaemia |
| Allele Phenotype: | β0 |
| Associated Phenotypes: | N/A |
Location
| Chromosome: | 11 |
|---|---|
| Locus: | NG_000007.3 |
| Locus Location: | 71015 |
| Size: | 4 bp |
| Located at: | β |
| Specific Location: | Exon 2 |
Other details
| Type of Mutation: | Point-Mutation(Insertion) |
|---|---|
| Effect on Gene/Protein Function: | Frameshift (Translation) |
| Ethnic Origin: | Mexican |
| Molecular mechanism: | N/A |
| Inheritance: | Recessive |
| DNA Sequence Determined: | Yes |
In silico pathogenicity prediction
Publications / Origin
- Martínez Villegas O, Mendoza-Meléndez D, Trueba-Gómez R, Rosenfeld-Mann F, Baptista-González HA, Estrada-Juárez H, Analysis of a Novel Mexican Variant of the Gene Associated with β-Thalassemia Using Bioinformatic Tools., Hemoglobin, 45(2), 87-93, 2021
Created on 2022-01-28 14:00:10,
Last reviewed on 2022-08-24 09:24:44 (Show full history)
Disclaimer: The information on this website is provided as an information resource only
and must not to be used as a substitute for professional diagnosis and treatment.
The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment,
diagnosis or any other information, services or products that an individual obtains through this website.