IthaID: 4155

Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 124/125 (-AC) HGVS Name: HBB:c.375_376delAC
Hb Name: N/A Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
TCACTTTGGCAAAGAATTCACCCC [AC/-] CAGTGCAGGCTGCCTATCAGAAAG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPSAGCLSESGFWCX

Comments: Identified in an adult male in compound heterozygosity with the Hb E variant [IthaID: 88]. The 2 bp deletion causes a frameshift, resulting in a premature stop codon fourteen amino acids downstream, and leads to a non-functional beta-globin protein. The patient exhibited clinical features of thalassemia, including pallor of the conjunctivae, prominent frontal bossing, and palpable hepatosplenomegaly. He had a history of occasional blood transfusions when haemoglobin levels fell below 8 g/dL, up to the age of 17. Following hospitalization for high fever at age 26, his condition progressively worsened, necessitating regular monthly transfusions within a year, and resulting in severe hepatic iron overload. At age 36, he presented with massive splenomegaly requiring splenectomy. The patient died at age 37 due to septic shock and multi-organ failure.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 71949
Size: 2 bp
Located at: β
Specific Location: Exon 3

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Malay
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Publications / Origin

To the best of our knowledge, this is unpublished data. Please use with caution!

Microattributions

A/AContributor(s)DateComments
1Aziz, Nur Aisyah2025-07-30First report.
Created on 2025-07-31 09:11:40, Last reviewed on 2025-07-31 09:13:46 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.