IthaID: 3609



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: N/A
Common Name: CD 20/21 (-TGGA) HGVS Name: HBB:c.62_65delTGGA
Hb Name: N/A Protein Info: N/A

Context nucleotide sequence:
TGCCGTTACTGCCCTGTGGGGCAAGGTGAACG [TGGA/-] TGAAGTTGGTGGTGAGGCCCTGGGCAGGCTGC (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVKLVVRPWAGCWWSTLGPRGSLSPLGICPLLMLLWATLRX

Also known as:

Comments: Found in an asymptomatic 39-years old Spanish man with microcytic hypochromic red cells and an increased level of Hb A2 (5.1%). The 4-bp frameshift deletion creates a premature stop codon at the amino acid 60 resulting to a truncated β chain.

External Links

No available links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: N/A

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70656
Size: 4 bp
Located at: β
Specific Location: Exon 1

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Spanish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: Yes

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Publications / Origin

  1. Ropero P, González FA, Villas JM, Paúl R, Villegas A, The novo 4 BP deletion in the codons 20/21 (-TGGA) at the first exon of the beta-globin gene causing a beta0-thalassemia in a Spanish male., Ann. Hematol., 87(1), 63-5, 2008 PubMed
Created on 2020-08-10 11:09:29, Last reviewed on (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.