IthaID: 179



Names and Sequences

Functionality: Globin gene causative mutation Pathogenicity: Pathogenic / Likely Pathogenic
Common Name: CD 75 (-C) HGVS Name: HBB:c.226delC
Hb Name: N/A Protein Info: N/A
Also known as:

We follow the HGVS sequence variant nomenclature and IUPAC standards.

Context nucleotide sequence:
GTGCTCGGTGCCTTTAGTGATGGC [C/-] TGGCTCACCTGGACAACCTCAAGG (Strand: -)

Protein sequence:
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGWLTWTTSRAPLPHX

Comments: The T deletion at codon 75, creating a change in the reading frame that results in a premature termination of translation because of a stop codon at codon 88 (TGA).

External Links

Phenotype

Hemoglobinopathy Group: Thalassaemia
Hemoglobinopathy Subgroup: β-thalassaemia
Allele Phenotype:β0
Associated Phenotypes: Haemolytic anaemia [HP:0001878]
Ineffective erythropoiesis [HP:0010972]

Location

Chromosome: 11
Locus: NG_000007.3
Locus Location: 70950
Size: 1 bp
Located at: β
Specific Location: Exon 2

Other details

Type of Mutation: Point-Mutation(Deletion)
Effect on Gene/Protein Function: Frameshift (Translation)
Ethnic Origin: Turkish
Molecular mechanism: N/A
Inheritance: Recessive
DNA Sequence Determined: No

In silico pathogenicity prediction

Sequence Viewer

Note: The NCBI Sequence Viewer is not installed on the ITHANET servers but it is embedded in this page from the NCBI. Therefore, IthaGenes has no responsibility over any temporary unavailability of the service. In such a case, please Refresh the page or retry at a later stage. Otherwise, use this external link.

Frequencies

Publications / Origin

  1. Başak AN, Ozçelik H, Ozer A, Tolun A, Aksoy M, Ağaoğlu L, Ridolfi F, Ulukutlu L, Akar N, Gürgey A, The molecular basis of beta-thalassemia in Turkey., Human genetics, 89(3), 315-8, 1992 PubMed
  2. Başak AN, Ozer A, Ozçelik H, Kirdar B, Gürgey A, A novel frameshift mutation: deletion of C in codons 74/75 of the beta-globin gene causes beta zero-thalassemia in a Turkish patient., Hemoglobin, 16(4), 309-12, 1992 PubMed
Created on 2010-06-16 16:13:15, Last reviewed on 2021-04-08 12:55:21 (Show full history)

Disclaimer: The information on this website is provided as an information resource only and must not to be used as a substitute for professional diagnosis and treatment. The ITHANET Portal and IthaGenes are not responsible or liable for any advice, course of treatment, diagnosis or any other information, services or products that an individual obtains through this website.